Evl Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324906
| Artikelname: |
Evl Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324906 |
| Hersteller Artikelnummer: |
orb324906 |
| Alternativnummer: |
BYT-ORB324906-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Evl |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti AI528774 antibody |
| Rabbit polyclonal antibody to Evl |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
42kDa |
| NCBI: |
031991 |
| UniProt: |
Q6PB99 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: FSNAMLFALNIMNSQEGGPSTQRQVQNGPSPEEMDIQRRQVMEQQHRQES |
| Target-Kategorie: |
Evl |
|
WB Suggested Anti-Evl Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Stomach. |