Sugp1 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324917
Artikelname: Sugp1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324917
Hersteller Artikelnummer: orb324917
Alternativnummer: BYT-ORB324917-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: anti 5730496N02Rik antibody, anti Sf4 antibody
Rabbit polyclonal antibody to Sugp1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 73kDa
NCBI: 081757
UniProt: Q8CH02
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: NYSHAKQLPVAHRPSVFQSPDDDEEEDYEQWLEIKVSPPEGAETRRVIEK
Target-Kategorie: Sugp1
WB Suggested Anti-Sugp1 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Thymus.