ADAD2 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324936
Artikelname: ADAD2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324936
Hersteller Artikelnummer: orb324936
Alternativnummer: BYT-ORB324936-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ADAD2
Konjugation: Unconjugated
Alternative Synonym: anti FLJ00337 antibody, anti TENRL antibody
Rabbit polyclonal antibody to ADAD2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 71kDa
NCBI: 631913
UniProt: Q8NCV1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAF
Target-Kategorie: ADAD2
WB Suggested Anti-ADAD2 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.