ERI1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324941
| Artikelname: |
ERI1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324941 |
| Hersteller Artikelnummer: |
orb324941 |
| Alternativnummer: |
BYT-ORB324941-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human ERI1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti 3HEXO antibody, anti MGC35395 antibody, anti HEXO antibody, anti THEX1 antibody |
| Rabbit polyclonal antibody to ERI1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
349 |
| NCBI: |
699163 |
| UniProt: |
Q8IV48 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: SKFITSSASDFSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKD |
| Target-Kategorie: |
ERI1 |
![]()
|
Sample Tissue: Human Lung Tumor lysates, Antibody Dilution: 1 ug/mL. |
