FER1L3 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: FER1L3 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB325305
• Hersteller Artikelnummer: orb325305
• Alternativnummer: BYT-ORB325305-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FER1L3
• Konjugation: Unconjugated
• Alternative Synonym: anti FLJ36571 antibody, anti FLJ90777 antibody, anti MYOF antibody, anti FER1L3 antibody

Produktbeschreibung

Rabbit polyclonal antibody to MYOF

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 235 kDa
• NCBI: 038479
• UniProt: Q9NZM1
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM
• Target-Kategorie: MYOF

Bilder

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, MYOF is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Sample Type: Hela, Antibody Dilution: 1.0 ug/mL, MYOF is strongly supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-FER1L3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate, MYOF is strongly supported by BioGPS gene expression data to be expressed in MCF7.