ZSCAN22 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325364
| Artikelname: |
ZSCAN22 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325364 |
| Hersteller Artikelnummer: |
orb325364 |
| Alternativnummer: |
BYT-ORB325364-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZSC22 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti ZSCAN22 antibody, anti HKR2 antibody, anti ZNF50 antibody, anti antibody |
| Rabbit polyclonal antibody to ZSC22 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
54kDa |
| NCBI: |
006723255 |
| UniProt: |
P10073 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: ESEPSNVTETLMGGVSLGPAFVKACEPEGSSERSGLSGEIWTKSVTQQIH |
| Target-Kategorie: |
ZSCAN22 |
