HCG_20426 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325367
Artikelname: HCG_20426 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325367
Hersteller Artikelnummer: orb325367
Alternativnummer: BYT-ORB325367-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human hCG_20426
Konjugation: Unconjugated
Alternative Synonym: anti LOC441869 antibody, anti hCG_20426 antibody
Rabbit polyclonal antibody to ANKRD65
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 42kDa
NCBI: 001126121
UniProt: E5RJM6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LAAERGHGPTVGLLLSRGASPTLRTQWAEVAQMPEGDLPQALPELGGGEK
Target-Kategorie: ANKRD65