Thg1l Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325369
| Artikelname: |
Thg1l Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325369 |
| Hersteller Artikelnummer: |
orb325369 |
| Alternativnummer: |
BYT-ORB325369-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti 1700121M19Rik antibody, anti 5730409G07Rik antibody, anti AA387658 antibody, anti MGC107321 antibody, anti RP23-298M7.6 antibody |
| Rabbit polyclonal antibody to Thg1l |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
35kDa |
| NCBI: |
001074438 |
| UniProt: |
Q9CY52 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: RNFHRFAEEHNFAKPNDSRALHLMTKCAQTVMEELEDIVIAYGQSDEYSF |
| Target-Kategorie: |
Thg1l |
