GNB2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325390
| Artikelname: |
GNB2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325390 |
| Hersteller Artikelnummer: |
orb325390 |
| Alternativnummer: |
BYT-ORB325390-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human GNB2 |
| Konjugation: |
Unconjugated |
| Rabbit polyclonal antibody to GNB2 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
37kDa |
| NCBI: |
005264 |
| UniProt: |
P62879 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGR |
| Target-Kategorie: |
GNB2 |
