TEX10 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325391
Artikelname: TEX10 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325391
Hersteller Artikelnummer: orb325391
Alternativnummer: BYT-ORB325391-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TEX10
Konjugation: Unconjugated
Alternative Synonym: Ipi1, bA208F1.2
Rabbit polyclonal antibody to TEX10
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 47kDa
NCBI: 001155056
UniProt: Q9NXF1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: RLTSQQWRLKVLVRLSKFLQALADGSSRLRESEGLQEQKENPHATSNSIF
Target-Kategorie: TEX10