NUDT16L1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325395
| Artikelname: |
NUDT16L1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325395 |
| Hersteller Artikelnummer: |
orb325395 |
| Alternativnummer: |
BYT-ORB325395-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human NUDT16L1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti MGC11275 antibody, anti SDOS antibody |
| Rabbit polyclonal antibody to NUDT16L1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
1.0 mg/ml |
| Molekulargewicht: |
23kDa |
| NCBI: |
115725 |
| UniProt: |
Q9BRJ7 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVE |
| Target-Kategorie: |
NUDT16L1 |
