NUDT17 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325397
Artikelname: NUDT17 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325397
Hersteller Artikelnummer: orb325397
Alternativnummer: BYT-ORB325397-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NUD17
Konjugation: Unconjugated
Alternative Synonym: anti NUDT17 antibody, anti antibody
Rabbit polyclonal antibody to NUD17
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 36kDa
NCBI: 001012776
UniProt: P0C025
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: RMIPTMAEDKERVSTGTKFALKLWLQHLGRTPPPCKSAAYLDPGPAKEEW
Target-Kategorie: NUDT17