LIPT1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325414
| Artikelname: |
LIPT1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325414 |
| Hersteller Artikelnummer: |
orb325414 |
| Alternativnummer: |
BYT-ORB325414-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human LIPT |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti LIPT1 antibody, anti antibody |
| Rabbit polyclonal antibody to LIPT |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
41kDa |
| NCBI: |
660200 |
| UniProt: |
Q9Y234 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: RALNAVQPQLDVQATKRFDLLLDGQFKISGTASKIGRTTAYHHCTLLCST |
| Target-Kategorie: |
LIPT1 |
