Pcmtd2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325422
| Artikelname: |
Pcmtd2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325422 |
| Hersteller Artikelnummer: |
orb325422 |
| Alternativnummer: |
BYT-ORB325422-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Pcmtd2 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti 5330414D10Rik antibody, anti AI314201 antibody |
| Rabbit polyclonal antibody to Pcmtd2 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
41kDa |
| NCBI: |
705822 |
| UniProt: |
Q8BHD8 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: LDKEVFASRISNPSDDTSCEDAEEDRREVAERTLQETKPEPPVNFLRQRV |
| Target-Kategorie: |
Pcmtd2 |
