TTC7A Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325425
Artikelname: TTC7A Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325425
Hersteller Artikelnummer: orb325425
Alternativnummer: BYT-ORB325425-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human TTC7A
Konjugation: Unconjugated
Alternative Synonym: TTC7, GIDID, MINAT
Rabbit polyclonal antibody to TTC7A
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 55kDa
NCBI: 001275880
UniProt: Q9ULT0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: EAGEFLPKGYLALGLTYSLQATDATLKSKQDELHRKALQTLERAQQLAPS
Target-Kategorie: TTC7A