DHDDS Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325429
Artikelname: DHDDS Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325429
Hersteller Artikelnummer: orb325429
Alternativnummer: BYT-ORB325429-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DHDDS
Konjugation: Unconjugated
Alternative Synonym: DS, CIT, CPT, HDS, RP59, hCIT, DEDSM
Rabbit polyclonal antibody to DHDDS
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 39kDa
UniProt: Q86SQ9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: ARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARR
Target-Kategorie: DHDDS