PNPLA5 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325433
Artikelname: PNPLA5 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325433
Hersteller Artikelnummer: orb325433
Alternativnummer: BYT-ORB325433-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PNPLA5
Konjugation: Unconjugated
Alternative Synonym: anti 4833426H19Rik antibody, anti GS2L antibody, anti dJ388M5 antibody, anti dJ388M5.4 antibody
Rabbit polyclonal antibody to PNPLA5
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 48kDa
NCBI: 620169
UniProt: Q7Z6Z6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: NMALEVFSRTKAQLLGPISPPATRVLETSPLQPQIAPHREELGPTHQA
Target-Kategorie: PNPLA5