ST6GALNAC3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325441
| Artikelname: |
ST6GALNAC3 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325441 |
| Hersteller Artikelnummer: |
orb325441 |
| Alternativnummer: |
BYT-ORB325441-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human ST6GALNAC3 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti PRO7177 antibody, anti SIAT7C antibody, anti ST6GALNACIII antibody, anti STY antibody |
| Rabbit polyclonal antibody to ST6GALNAC3 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
35 kDa |
| NCBI: |
694541 |
| UniProt: |
Q8NDV1 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT |
| Target-Kategorie: |
ST6GALNAC3 |
