ST6GALNAC4 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325444
| Artikelname: |
ST6GALNAC4 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325444 |
| Hersteller Artikelnummer: |
orb325444 |
| Alternativnummer: |
BYT-ORB325444-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human ST6GALNAC4 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti SIAT3C antibody, anti SIAT7D antibody, anti ST6GALNACIV antibody |
| Rabbit polyclonal antibody to ST6GALNAC4 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
34kDa |
| NCBI: |
778204 |
| UniProt: |
Q9H4F1 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: QLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMIL |
| Target-Kategorie: |
ST6GALNAC4 |
