GLT6D1 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325448
Artikelname: GLT6D1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325448
Hersteller Artikelnummer: orb325448
Alternativnummer: BYT-ORB325448-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GLT6D1
Konjugation: Unconjugated
Alternative Synonym: anti GLTDC1 antibody, anti GT6M7 antibody
Rabbit polyclonal antibody to GLT6D1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 32kDa
NCBI: 892019
UniProt: Q7Z4J2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM
Target-Kategorie: GLT6D1