GLYATL1 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325465
Artikelname: GLYATL1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325465
Hersteller Artikelnummer: orb325465
Alternativnummer: BYT-ORB325465-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GLYL1
Konjugation: Unconjugated
Alternative Synonym: anti GLYATL1 antibody, anti GNAT antibody, anti antibody
Rabbit polyclonal antibody to GLYL1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 36kDa
NCBI: 542392
UniProt: Q969I3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SKSVKVEHSRALLLVTEDILKLNASSKSKLGSWAETGHPDDEFESETPNF
Target-Kategorie: GLYATL1