TMCO1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325475
| Artikelname: |
TMCO1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325475 |
| Hersteller Artikelnummer: |
orb325475 |
| Alternativnummer: |
BYT-ORB325475-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human TMCO1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti HP10122 antibody, anti PCIA3 antibody, anti PNAS-136 antibody, anti RP11-466F5.7 antibody, anti TMCC4 antibody |
| Rabbit polyclonal antibody to TMCO1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
21kDa |
| NCBI: |
061899 |
| UniProt: |
Q9UM00 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS |
| Target-Kategorie: |
TMCO1 |
