TMEM63C Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325481
Artikelname: TMEM63C Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325481
Hersteller Artikelnummer: orb325481
Alternativnummer: BYT-ORB325481-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMEM63C
Konjugation: Unconjugated
Alternative Synonym: anti C14orf171 antibody
Rabbit polyclonal antibody to TMEM63C
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 93kDa
NCBI: 065164
UniProt: Q9P1W3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: EEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTM
Target-Kategorie: TMEM63C