C20orf3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325482
| Artikelname: |
C20orf3 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325482 |
| Hersteller Artikelnummer: |
orb325482 |
| Alternativnummer: |
BYT-ORB325482-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf3 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti APMAP antibody, anti BSCv antibody, anti C20orf3 antibody |
| Rabbit polyclonal antibody to APMAP |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
46 kDa |
| NCBI: |
065392 |
| UniProt: |
Q9HDC9 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK |
| Target-Kategorie: |
APMAP |
