MRS2L Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325484
Artikelname: MRS2L Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325484
Hersteller Artikelnummer: orb325484
Alternativnummer: BYT-ORB325484-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MRS2L
Konjugation: Unconjugated
Alternative Synonym: anti HPT antibody, anti MGC78523 antibody, anti MRS2 antibody, anti MRS2L antibody
Rabbit polyclonal antibody to MRS2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 50kDa
NCBI: 065713
UniProt: Q9HD23
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEEL
Target-Kategorie: MRS2