TXNDC16 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325486
Artikelname: TXNDC16 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325486
Hersteller Artikelnummer: orb325486
Alternativnummer: BYT-ORB325486-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TXNDC16
Konjugation: Unconjugated
Alternative Synonym: anti KIAA1344 antibody
Rabbit polyclonal antibody to TXNDC16
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 93kDa
NCBI: 065835
UniProt: Q9P2K2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV
Target-Kategorie: TXNDC16