LRRC4C Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325489
Artikelname: LRRC4C Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325489
Hersteller Artikelnummer: orb325489
Alternativnummer: BYT-ORB325489-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC4C
Konjugation: Unconjugated
Alternative Synonym: anti KIAA1580 antibody, anti NGL-1 antibody, anti NGL1 antibody
Rabbit polyclonal antibody to LRRC4C
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 72kDa
NCBI: 065980
UniProt: Q9HCJ2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE
Target-Kategorie: LRRC4C