GPR107 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325490
Artikelname: GPR107 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325490
Hersteller Artikelnummer: orb325490
Alternativnummer: BYT-ORB325490-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GP107
Konjugation: Unconjugated
Alternative Synonym: anti GPR107 antibody, anti KIAA1624 antibody, anti LUSTR1 antibody, anti antibody
Rabbit polyclonal antibody to GP107
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 66kDa
UniProt: Q5VW38
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCL
Target-Kategorie: GPR107