SPINT2 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325491
Artikelname: SPINT2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325491
Hersteller Artikelnummer: orb325491
Alternativnummer: BYT-ORB325491-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SPIT2
Konjugation: Unconjugated
Alternative Synonym: anti SPINT2 antibody, anti HAI2 antibody, anti KOP antibody, anti antibody
Rabbit polyclonal antibody to SPIT2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 27kDa
NCBI: 066925
UniProt: O43291
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: ATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRA
Target-Kategorie: SPINT2