C19orf15 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325494
Artikelname: C19orf15 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325494
Hersteller Artikelnummer: orb325494
Alternativnummer: BYT-ORB325494-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C19orf15
Konjugation: Unconjugated
Alternative Synonym: anti DKFZP434A1022 antibody, anti FLJ38899 antibody, anti FLJ46353 antibody, anti MGC125664 antibody, anti C19orf15 antibody
Rabbit polyclonal antibody to CATSPERG
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 92kDa
NCBI: 067008
UniProt: Q6ZRH7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: FFLIQDLVTGDSGSFQGSYVLLVVGGGPTLDSLKDYSEDEIYRFNSPLDK
Target-Kategorie: CATSPERG