CLEC7A Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325506
| Artikelname: |
CLEC7A Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325506 |
| Hersteller Artikelnummer: |
orb325506 |
| Alternativnummer: |
BYT-ORB325506-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CLC7A |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti CLEC7A antibody, anti BGR antibody, anti CLECSF12 antibody, anti DECTIN1 antibody, anti UNQ539/PRO1082 antibody, anti antibody |
| Rabbit polyclonal antibody to CLC7A |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
27kDa |
| UniProt: |
Q9BXN2 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: GYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVV |
| Target-Kategorie: |
CLEC7A |
