EED Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: EED Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB329845
• Hersteller Artikelnummer: orb329845
• Alternativnummer: BYT-ORB329845-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ICC, IF, WB
• Spezies Reaktivität: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EED
• Konjugation: Unconjugated
• Alternative Synonym: anti HEED antibody, anti WAIT1 antibody

Produktbeschreibung

Rabbit polyclonal antibody to EED

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 50kDa
• NCBI: 003788
• UniProt: O75530
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC
• Target-Kategorie: EED

Bilder

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Stomach, Antibody Dilution: 1.0 ug/mL.

Sample Type: Rat Brain lysate, Dilution: 1:500.

WB Suggested Anti-EED Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:2500, Positive Control: OVCAR-3 cell lysate, EED is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.