WT1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB329950
| Artikelname: |
WT1 antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB329950 |
| Hersteller Artikelnummer: |
orb329950 |
| Alternativnummer: |
BYT-ORB329950-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Canine, Equine, Human, Mouse, Porcine, Rat, Zebrafish |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human WT1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
Anti-2310001G03Rik antibody, anti-PAR 4 antibody, anti-PAR-4 antibody, anti-Pawr antibody, anti-PAWR_HUMAN antibody, anti-PRKC Apoptosis WT1 Regulator antibody, anti-PRKC apoptosis WT1 regulator protein antibody, anti-Prostate apoptosis response 4 protei |
| Rabbit polyclonal antibody to WT1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
49 kDa |
| NCBI: |
077742 |
| UniProt: |
P19544 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA |
| Target-Kategorie: |
WT1 |
