THRB antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: THRB antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: BYT-ORB329953
• Hersteller Artikelnummer: orb329953
• Alternativnummer: BYT-ORB329953-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THRB
• Konjugation: Unconjugated
• Alternative Synonym: anti ERBA-BETA antibody, anti ERBA2 antibody, anti GRTH antibody, anti MGC126109 antibody, anti MGC126110 antibody, anti NR1A2 antibody, anti THR1 antibody, anti THRB1 antibody, anti THRB2 antibody, anti PRTH antibody, anti C-ERBA-2 antibody, anti C-ERBA

Produktbeschreibung

Rabbit polyclonal antibody to THRB

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 53kDa
• NCBI: 000452
• UniProt: P10828
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: YQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKV
• Target-Kategorie: THRB