ACO1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB330127
| Artikelname: |
ACO1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB330127 |
| Hersteller Artikelnummer: |
orb330127 |
| Alternativnummer: |
BYT-ORB330127-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human, Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human ACO1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti IRP1 antibody, anti ACONS antibody, anti IREB1 antibody, anti IREBP antibody, anti IREBP1 antibody |
| Rabbit polyclonal antibody to ACO1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
98kDa |
| NCBI: |
002188 |
| UniProt: |
P28271 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC |
| Target-Kategorie: |
ACO1 |
![]()
|
Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/mL. |
![]()
|
Sample Type: Fetal Kidney, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/Lane, Gel Concentration: 0.12. |
![]()
|
Lane 1: 100 ug HePG2 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti rabbit-HRP, Secondary Antibody Dilution: 1:8000, Gene Name: ACO1. |
![]()
|
Lanes: 1. 45 ug capan1 cell lysate, 2. 45 ug HPAF cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: ACO1. |
![]()
|
Lanes: 1. 60 ug mouse liver extract 2. 60 ug mouse liver extract 3. 60 ug mouse liver extract, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:3000, Gene Name: ACO1. |
![]()
|
Rabbit Anti-ACO1 Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X. |
![]()
|
Sample Type: Human Capan1 cells (Pancreatic cancer cell line), Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-AlexaFluor-488, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: ACO1: Green DAPI: Blue, Gene Name: ACO1. |
![]()
|
WB Suggested Anti-ACO1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human kidney. |
