SDF4 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB330503
Artikelname: |
SDF4 antibody, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB330503 |
Hersteller Artikelnummer: |
orb330503 |
Alternativnummer: |
BYT-ORB330503-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human SDF4 |
Konjugation: |
Unconjugated |
Alternative Synonym: |
anti Cab45 antibody, anti RP5-902P8.6 antibody, anti SDF-4 antibody |
Rabbit polyclonal antibody to SDF4 |
Klonalität: |
Polyclonal |
Konzentration: |
0.5 mg/ml |
Molekulargewicht: |
39kDa |
NCBI: |
057631 |
UniProt: |
B1AME6 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequenz: |
Synthetic peptide located within the following region: KTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEE |
Target-Kategorie: |
SDF4 |