SDF4 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB330503
| Artikelname: |
SDF4 antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB330503 |
| Hersteller Artikelnummer: |
orb330503 |
| Alternativnummer: |
BYT-ORB330503-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human SDF4 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti Cab45 antibody, anti RP5-902P8.6 antibody, anti SDF-4 antibody |
| Rabbit polyclonal antibody to SDF4 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
39kDa |
| NCBI: |
057631 |
| UniProt: |
B1AME6 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: KTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEE |
| Target-Kategorie: |
SDF4 |
