Human EIF2AK2 protein

Produktübersicht

• Artikelname: Human EIF2AK2 protein
• Artikelnummer: BYT-ORB358086
• Hersteller Artikelnummer: orb358086
• Alternativnummer: BYT-ORB358086-1,BYT-ORB358086-100,BYT-ORB358086-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Eukaryotic translation initiation factor 2-alpha kinase 2

Produktbeschreibung

This Human EIF2AK2 protein spans the amino acid sequence from region 2-551aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 78 kDa
• UniProt: P19525
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAKRSLAPRFDLPDMKETK

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 2-551aa

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) EIF2AK2.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) EIF2AK2.

Flow cytometric analysis of E.coli-expressed Homo sapiens (Human) using Human EIF2AK2 protein.

Flow cytometric analysis of E.coli-expressed Homo sapiens (Human) using Human EIF2AK2 protein.

SDS-Page analysis of Human EIF2AK2 protein.