Animal OP-3 protein

Produktübersicht

• Artikelname: Animal OP-3 protein
• Artikelnummer: BYT-ORB358148
• Hersteller Artikelnummer: orb358148
• Alternativnummer: BYT-ORB358148-1,BYT-ORB358148-100,BYT-ORB358148-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Antifreeze protein lambda OP-3

Produktbeschreibung

This Animal OP-3 protein spans the amino acid sequence from region 23-91aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 11.6 kDa
• UniProt: P19606
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Zoarces americanus (Ocean pout) (Macrozoarces americanus)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: NQSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPRLVSMQVNQAVPMGTTLMPDMVKFYCLCAPKN

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Zoarces americanus (Ocean pout) (Macrozoarces americanus). Application Notes: Full length of His-tag and expression region is 23-91aa

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Zoarces americanus (Ocean pout) (Macrozoarces americanus).

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Zoarces americanus (Ocean pout) (Macrozoarces americanus).