Animal OP-3 protein

Artikelnummer: BYT-ORB358148
Artikelname: Animal OP-3 protein
Artikelnummer: BYT-ORB358148
Hersteller Artikelnummer: orb358148
Alternativnummer: BYT-ORB358148-1,BYT-ORB358148-100,BYT-ORB358148-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Antifreeze protein lambda OP-3
This Animal OP-3 protein spans the amino acid sequence from region 23-91aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 11.6 kDa
UniProt: P19606
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Zoarces americanus (Ocean pout) (Macrozoarces americanus)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NQSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPRLVSMQVNQAVPMGTTLMPDMVKFYCLCAPKN
Anwendungsbeschreibung: Biological Origin: Zoarces americanus (Ocean pout) (Macrozoarces americanus). Application Notes: Full length of His-tag and expression region is 23-91aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Zoarces americanus (Ocean pout) (Macrozoarces americanus).
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Zoarces americanus (Ocean pout) (Macrozoarces americanus).