Human E6 protein

Produktübersicht

• Artikelname: Human E6 protein
• Artikelnummer: BYT-ORB358154
• Hersteller Artikelnummer: orb358154
• Alternativnummer: BYT-ORB358154-1,BYT-ORB358154-100,BYT-ORB358154-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: E6, Protein E6

Produktbeschreibung

This Human E6 protein spans the amino acid sequence from region 1-148aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 33.9 kDa
• UniProt: P36814
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Human papillomavirus type 52
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MFEDPATRPRTLHELCEVLEESVHEIRLQCVQCKKELQRREVYKFLFTDLRIVYRDNNPYGVCIMCLRFLSKISEYRHYQYSLYGKTLEERVKKPLSEITIRCIICQTPLCPEEKERHVNANKRFHNIMGRWTGRCSECWRPRPVTQV

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Human papillomavirus type 52. Application Notes: This is His-SUMO-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human papillomavirus type 52E6.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human papillomavirus type 52E6.