Bacterial fkpA protein

Artikelnummer: BYT-ORB358181
Artikelname: Bacterial fkpA protein
Artikelnummer: BYT-ORB358181
Hersteller Artikelnummer: orb358181
Alternativnummer: BYT-ORB358181-1,BYT-ORB358181-100,BYT-ORB358181-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Rotamase
This Bacterial fkpA protein spans the amino acid sequence from region 21-268aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 42.7 kDa
UniProt: O08437
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Aeromonas hydrophila
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: CQKDEKTAANTAEVKAEASKPAEAPKAEAKSFEEQSGYAIGLSMGRYIANTLERQQELGIKLDNSVILKGVTDGLGKEAKMTDEEIQKVLQQYDAKINELTKAKADKDAVENQKKGEEYLAANAKKEGVKSTESGLQYQVEKMGTGAKPKATDIVKVHYTGTLTDGTKFDSSVDRGEPATFPLNQVIPGWTEGVQLMPVGSKFKFFLPSKLAYGEHGAGSIPANAVLVFDVELLAIEKPAADGDNAKK
Anwendungsbeschreibung: Biological Origin: Aeromonas hydrophila. Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Aeromonas hydrophilafkpA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Aeromonas hydrophilafkpA.