Human CD206 protein

Produktübersicht

• Artikelname: Human CD206 protein
• Artikelnummer: BYT-ORB358245
• Hersteller Artikelnummer: orb358245
• Alternativnummer: BYT-ORB358245-1,BYT-ORB358245-100,BYT-ORB358245-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: C type lectin domain family 13 member D protein, C-type lectin domain family 13 member D protein, CD 206 protein, CD206 protein, CD206 antigen protein, CLEC13D protein, CLEC13DL protein, Macrophage mannose receptor 1 protein, Macrophage mannose receptor 1 like protein 1 protein, Macrophage mannose receptor protein, Mannose receptor C type 1 protein, Mannose receptor C type 1 like 1 protein, MMR protein, MRC 1 protein, MRC1 protein, MRC1L1 protein

Produktbeschreibung

This Human CD206 protein spans the amino acid sequence from region 655-1213aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 66.4 kDa
• UniProt: P22897
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: RTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVTMYSNSGFW

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.