Bacterial scn protein

Produktübersicht

• Artikelname: Bacterial scn protein
• Artikelnummer: BYT-ORB358383
• Hersteller Artikelnummer: orb358383
• Alternativnummer: BYT-ORB358383-1,BYT-ORB358383-100,BYT-ORB358383-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: SCIN

Produktbeschreibung

This Bacterial scn protein spans the amino acid sequence from region 32-116aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 25.8 kDa
• UniProt: Q99SU9
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Staphylococcus aureus (strain N315)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Staphylococcus aureus (strain N315). Application Notes: This is His-SUMO-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain N315) scn.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain N315) scn.