Viral VCATH protein

Produktübersicht

• Artikelname: Viral VCATH protein
• Artikelnummer: BYT-ORB358392
• Hersteller Artikelnummer: orb358392
• Alternativnummer: BYT-ORB358392-1,BYT-ORB358392-100,BYT-ORB358392-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cysteine proteinase Short name, CP

Produktbeschreibung

This Viral VCATH protein spans the amino acid sequence from region 113-323aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 39.9 kDa
• UniProt: P25783
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Autographa californica nuclear polyhedrosis virus (AcMNPV)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: PLEFDWRRLNKVTSVKNQGMCGACWAFATLASLESQFAIKHNQLINLSEQQMIDCDFVDAGCNGGLLHTAFEAIIKMGGVQLESDYPYEADNNNCRMNSNKFLVQVKDCYRYITVYEEKLKDLLRLVGPIPMAIDAADIVNYKQGIIKYCFNSGLNHAVLLVGYGVENNIPYWTFKNTWGTDWGEDGFFRVQQNINACGMRNELASTAVIY

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Autographa californica nuclear polyhedrosis virus (AcMNPV). Application Notes: This is His-SUMO-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Autographa californica nuclear polyhedrosis virus (AcMNPV) VCATH.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Autographa californica nuclear polyhedrosis virus (AcMNPV) VCATH.