Human LAMA5 protein
Artikelnummer:
BYT-ORB358395
- Bilder (3)
| Artikelname: | Human LAMA5 protein |
| Artikelnummer: | BYT-ORB358395 |
| Hersteller Artikelnummer: | orb358395 |
| Alternativnummer: | BYT-ORB358395-1,BYT-ORB358395-100,BYT-ORB358395-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Laminin-10 subunit alpha Laminin-11 subunit alpha Laminin-15 subunit alpha |
| This Human LAMA5 protein spans the amino acid sequence from region 3401-3692aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 47.1 kDa |
| UniProt: | O15230 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | FVAQMEGLGTRLRAQSRQRSRPGRWHKVSVRWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSKLPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATLPDVGLELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVLCDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPEPMAVQ |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Application Notes: This is His-SUMO-tag protein |



