Rat CD13 protein

Produktübersicht

• Artikelname: Rat CD13 protein
• Artikelnummer: BYT-ORB358451
• Hersteller Artikelnummer: orb358451
• Alternativnummer: BYT-ORB358451-1,BYT-ORB358451-100,BYT-ORB358451-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Alanyl aminopeptidase protein, Alanyl membrane aminopeptidase protein, Aminopeptidase M protein, Aminopeptidase N protein, ANPEP protein, AP M protein, AP N protein, AP-M protein, AP-N protein, APN protein, CD 13 protein, CD13 protein, CD13 antigen protein, gp150 protein, hAPN protein, Microsomal aminopeptidase protein, Myeloid plasma membrane glycoprotein CD13 protein, PEPN protein

Produktbeschreibung

This Rat CD13 protein spans the amino acid sequence from region 33-476aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 65.8 kDa
• UniProt: P15684
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Rattus norvegicus (Rat)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: YAQEKNRNAENSAIAPTLPGSTSATTSTTNPAIDESKPWNQYRLPKTLIPDSYQVTLRPYLTPNEQGLYIFKGSSTVRFTCNETTNVIIIHSKKLNYTNKGNHRVALRALGDTPAPNIDTTELVERTEYLVVHLQGSLVKGHQYEMDSEFQGELADDLAGFYRSEYMEGGNKKVVATTQMQAADARKSFPCFDEPAMKASFNITLIHPNNLTALSNMLPKDSRTLQEDPSWNVTEFHPTPKMSTYLLAYIVSEFK

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: This is His-SUMO-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Anpep.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Anpep.