Bacterial GV51_0914 protein

Artikelnummer: BYT-ORB358473
Artikelname: Bacterial GV51_0914 protein
Artikelnummer: BYT-ORB358473
Hersteller Artikelnummer: orb358473
Alternativnummer: BYT-ORB358473-1,BYT-ORB358473-100,BYT-ORB358473-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: /
This Bacterial GV51_0914 protein spans the amino acid sequence from region 1-525aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 62.2 kDa
UniProt: D6SZ78
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Gardnerella vaginalis 5-1
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MKDTFCSYYTNSDEITSYMVNRLEIEENDIILEPSAGEGIFIDQILNSNKMIQIDALDINAEAIKILNSKYQDLPSITVRETDTLLDERLDLLSSPELWIKQTDTLLDEQLNFFGSIGGHYNKVIGNPPYGAWQDYDKRAQLKKKYPGQYVKETYSLFLLRCISLLRNGGRLSFIIPDTYLFLNLHAKLRELLLTSTRIIEIITFPSKFFPGVSFGYSNLSIITLERTNKENALNNTVRIVQGFESANEFQLLLN
Anwendungsbeschreibung: Biological Origin: Gardnerella vaginalis 5-1. Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Gardnerella vaginalis 5-1GV51_0914.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Gardnerella vaginalis 5-1GV51_0914.