Dog Major allergen Can f 1 protein

Produktübersicht

• Artikelname: Dog Major allergen Can f 1 protein
• Artikelnummer: BYT-ORB358538
• Hersteller Artikelnummer: orb358538
• Alternativnummer: BYT-ORB358538-1,BYT-ORB358538-100,BYT-ORB358538-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Allergen Dog 1 Allergen, Can f 1

Produktbeschreibung

This Dog Major allergen Can f 1 protein spans the amino acid sequence from region 19-174aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 33.3 kDa
• UniProt: O18873
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Canis lupus familiaris (Dog) (Canis familiaris)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QDTPALGKDTVAVSGKWYLKAMTADQEVPEKPDSVTPMILKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYTAYEGQRVVFIQPSPVRDHYILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQEILELAQSETCSPGGQ

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Application Notes: This is His-SUMO-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Canis familiaris (Dog) (Canis lupus familiaris).

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Canis familiaris (Dog) (Canis lupus familiaris).