Insect rBla g 4 protein

Produktübersicht

• Artikelname: Insect rBla g 4 protein
• Artikelnummer: BYT-ORB358611
• Hersteller Artikelnummer: orb358611
• Alternativnummer: BYT-ORB358611-1,BYT-ORB358611-100,BYT-ORB358611-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Allergen Bla g IV Allergen, Bla g 4

Produktbeschreibung

This Insect rBla g 4 protein spans the amino acid sequence from region 13-182aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 35.8 kDa
• UniProt: P54962
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Blattella germanica (German cockroach) (Blatta germanica)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Blattella germanica (German cockroach) (Blatta germanica). Application Notes: This is His-SUMO-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Blattella germanica (German cockroach) (Blatta germanica) rBla g 4.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Blattella germanica (German cockroach) (Blatta germanica) rBla g 4.