Plant BETVIA protein

Produktübersicht

• Artikelname: Plant BETVIA protein
• Artikelnummer: BYT-ORB358691
• Hersteller Artikelnummer: orb358691
• Alternativnummer: BYT-ORB358691-1,BYT-ORB358691-100,BYT-ORB358691-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Allergen Bet v I-A Allergen: Bet v 1-A

Produktbeschreibung

This Plant BETVIA protein spans the amino acid sequence from region 2-160aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 33.4 kDa
• UniProt: P15494
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Betula pendula (European white birch) (Betula verrucosa)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Betula pendula (European white birch) (Betula verrucosa). Application Notes: This is His-SUMO-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Betula pendula (European white birch) (Betula verrucosa) BETVIA.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Betula pendula (European white birch) (Betula verrucosa) BETVIA.

SDS-Page analysis of Plant BETVIA protein.