Viral Nucleoprotein protein

Produktübersicht

• Artikelname: Viral Nucleoprotein protein
• Artikelnummer: BYT-ORB358797
• Hersteller Artikelnummer: orb358797
• Alternativnummer: BYT-ORB358797-1,BYT-ORB358797-100,BYT-ORB358797-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Nucleocapsid protein Protein N

Produktbeschreibung

This Viral Nucleoprotein protein spans the amino acid sequence from region 1-569aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 65 kDa
• UniProt: P13699
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSASKEIKSFLWTQSLRRELSGYCSNIKLQVVKDAQALLHGLDFSEVSNVQRLMRKERRDDNDLKRLRDLNQAVNNLVELKSTQQKSILRVGTLTSDDLLILAADLEKLKSKVIRTERPLSAGVYMGNLSSQQLDQRRALLNMIGMSGGNQGARAGRDGVVRVWDVKNAELLNNQFGTMPSLTLACLTKQGQVDLNDAVQALTDLGLIYTAKYPNTSDLDRLTQSHPILNMIDTKKSSLNISGYNFSLGAAVKAG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV). Application Notes: This is His-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed strain Mouse/Sierra Leone/Josiah/1976) (LASV) N.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed strain Mouse/Sierra Leone/Josiah/1976) (LASV) N.